PTM Viewer PTM Viewer

AT2G17890.1

Arabidopsis thaliana [ath]

calcium-dependent protein kinase 16

6 PTM sites : 2 PTM types

PLAZA: AT2G17890
Gene Family: HOM05D000059
Other Names: AtCDPK16,CDPK16; CPK16
Uniprot
Q7XJR9

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

For each protein all PTMs are highlighted by default in the respective protein sequence (right-hand side). One can adjust a selection of PTMs in the PTM table on the left-hand side. In addition, functional protein domains and sites can be underlined if desired.

In the PTM table per PTM the PTM position and type is indicated, as well as the plain peptide sequence that was identified by mass spectrometry. The respective proteomics study is indicated by a number, providing a link to consult the experimental details. Additional PTM meta-data includes various confidence measures such as peptide score provided by search algorithms, posterior error probability (PEP), precursor mass deviation (in ppm) and modification site probability. The available confidence meta-data can be consulted in the extended PTM table by clicking SHOW CONFIDENCE. However, in the default PTM table, a color-coding of confidence is provided with green indicating high confidence, olive medium confidence, grey low confidence, and no color an unassigned confidence. More details regarding this confidence assignment can be consulted in the tutorial or the Plant PTM Viewer manuscript.

Besides confidence measures, log2 fold changes between two conditions with significance values (P- or Q-values) are shown if provided in the respective publication. Log2 fold changes are colored in heatmap-like gradient (green = induced, red = repressed) and significant values are highlighted in green. To determine significance, we employed the threshold used in the respective publication. For more details on the quantitative measurements we refer to the experimental details and respective publication, as methodologies can differ.

On the bottom of the page one can send the whole protein or a part of the protein (i.e. a functional domain) to PTM Blast. This will display aligned protein sequences that potentially report aligned PTMs.

PTMs



PTM Type

Mod AA

Pos

Peptide

Exp ID

Conf
ph T 28 NPHPHPPLTVVK114
ph S 40 SPCSFMAVTIQK114
ph S 80 EKVISNNGR114
ub K 397 LKQFALR120
ph S 561 NVRSPPGYLISR114
ph S 568 SPPGYLISR114

Sequence

Length: 571

MGLCFSSAAKSSGHNRSSRNPHPHPPLTVVKSRPPRSPCSFMAVTIQKDHRTQPRRNATAKKTPTRHTPPHGKVREKVISNNGRRHGETIPYGKRVDFGYAKDFDHRYTIGKLLGHGQFGYTYVATDKKTGDRVAVKKIDKAKMTIPIAVEDVKREVKILQALTGHENVVRFYNAFEDKNSVYIVMELCEGGELLDRILARKDSRYSERDAAVVVRQMLKVAAECHLRGLVHRDMKPENFLFKSTEEDSPLKATDFGLSDFIKPGKKFHDIVGSAYYVAPEVLKRRSGPESDVWSIGVISYILLCGRRPFWDKTEDGIFKEVLKNKPDFRRKPWPTISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKFSRLKQFALRALATTLDEEELADLRDQFDAIDVDKNGVISLEEMRQALAKDHPWKLKDARVAEILQAIDSNTDGFVDFGEFVAAALHVNQLEEHDSEKWQQRSRAAFEKFDIDGDGFITAEELRMHTGLKGSIEPLLEEADIDNDGKISLQEFRRLLRTASIKSRNVRSPPGYLISRKV

ID PTM Type Color
ph Phosphorylation X
ub Ubiquitination X
Multiple types X

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR000719 108 368
IPR002048 411 483
490 555
Sites
Show Type Position
Site 234
Active Site 114
Active Site 137
Active Site 424
Active Site 426
Active Site 428
Active Site 435
Active Site 461
Active Site 463
Active Site 465
Active Site 472
Active Site 503
Active Site 505
Active Site 507
Active Site 514
Active Site 533
Active Site 535
Active Site 537
Active Site 539
Active Site 544

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here